DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and DPM1

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_015509.1 Gene:DPM1 / 856313 SGDID:S000006387 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:80/241 - (33%)
Similarity:127/241 - (52%) Gaps:16/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYSILMPTYNEKDNL-PIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKIVL 70
            :||:::|.|:||.|: |:...|..........:.|:|.:||.|.||:::....|.......:|::
Yeast     4 EYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIV 68

  Fly    71 RPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGV 135
            |.  ::.||.:|.:.|...|.|.::|.:||||.|.|:.:|:..:...:..:.:  |||||...|:
Yeast    69 RT--NERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTL--GTRYAPGVGI 129

  Fly   136 -FGWDFKRKLISRGANFLSQVLLRPNASD-LTGSFRLYKKDVLEKCIASCV-SKGYVFQMEMLVR 197
             ..|...|::||..|..:::.|  ..||| ::|.|.|.|| .||.|....: |:|:...:|:|.:
Yeast   130 DKDWPMYRRVISSTARMMARPL--TIASDPMSGFFGLQKK-YLENCNPRDINSQGFKIALELLAK 191

  Fly   198 ---ARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNL--LYLF 238
               .|.....|.|||.||..|..|.|||.|..|||:.:.|  ||:|
Yeast   192 LPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 80/241 (33%)
DPM1_like 10..237 CDD:133062 76/235 (32%)
DPM1NP_015509.1 DPM1_like 7..234 CDD:133062 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343924
Domainoid 1 1.000 72 1.000 Domainoid score I2218
eggNOG 1 0.900 - - E1_COG0463
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1438
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61609
OrthoFinder 1 1.000 - - FOG0003124
OrthoInspector 1 1.000 - - oto100389
orthoMCL 1 0.900 - - OOG6_100818
Panther 1 1.100 - - LDO PTHR43398
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4337
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.