DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and ALG5

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_015097.1 Gene:ALG5 / 855874 SGDID:S000006148 Length:334 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:55/246 - (22%)
Similarity:109/246 - (44%) Gaps:19/246 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SILMPTYNEKDNLPIIIWLIVKYMKAS-GLEYEVIVIDDGSPDGT----LDVAKDLQKIYGEDKI 68
            |:::|:|||...:.:::...:.::|.. |..:|::::||||.|.|    |.:.|:..|:..|...
Yeast    76 SVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFR 140

  Fly    69 VLRPRGSKLGLGTAYIHGIKHATGDFIVIIDAD----LSHHPKFIPEFIKLQQEGN--------Y 121
            :::...:: |.|.|...|..|..|.:.:..|||    .|...|.|....|::....        .
Yeast   141 IIKFSQNR-GKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAV 204

  Fly   122 DIVSGTRYAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSK 186
            .|.|.........|......|..:..|.:.|..:....:..|....|:|:.:..:.|......::
Yeast   205 AIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTE 269

  Fly   187 GYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYL 237
            |::|.:|:|:.|.:....|.|:||:: ..:.|:......:.|:.||:|:.:
Yeast   270 GWIFDVEILILAIRKRIQIEEIPISW-HEVDGSKMALAIDSIKMAKDLVII 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 55/246 (22%)
DPM1_like 10..237 CDD:133062 54/243 (22%)
ALG5NP_015097.1 DPG_synthase 77..302 CDD:133031 50/226 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0463
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.830698 Normalized mean entropy S787
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.