DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLA10

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_173818.1 Gene:CSLA10 / 839019 AraportID:AT1G24070 Length:552 Species:Arabidopsis thaliana


Alignment Length:257 Identity:56/257 - (21%)
Similarity:89/257 - (34%) Gaps:114/257 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GHK-YSILM---PTYNEKDNLPI-------IIW----LIVKYMKASGLEYEVIVIDDGSPDGTLD 54
            ||: |.:::   |.||||:.|.:       :||    |||:            |:|| |.|.|:.
plant   117 GHETYPMVLVQIPMYNEKEVLQLSIGAACRLIWPLDRLIVQ------------VLDD-STDQTIK 168

  Fly    55 VAKDLQKIYGEDK---IVLRPRGSKLGL-GTAYIHGIKH---ATGDFIVIIDADLSHHPKFI--- 109
            ...:.:....|.|   |....|.::.|. ..|...|:||   ...:::||.|||....|.::   
plant   169 ELVNTECAKWESKGVNIKCERRDNRNGYKAGALKEGMKHNYVKLCNYVVIFDADFQPEPDYLQHS 233

  Fly   110 -------PEFIKLQ----------------QEG--NYDIVS-----GTRYA-----GNGGVF--- 136
                   ||...:|                ||.  ||..::     .||:|     |..||:   
plant   234 VPFLVHNPEVALVQARWRFMNANKCLMTRMQEMSLNYHFMAEQESGSTRHAFFSFNGTAGVWRMA 298

  Fly   137 --------------------------GWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYK 172
                                      ||.|.         ||:.:.::   |:|...|:.::
plant   299 AMEEAGGWHDRTTVEDMDLAVRAGLLGWKFV---------FLNDLTVK---SELPSKFKAFR 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 56/257 (22%)
DPM1_like 10..237 CDD:133062 53/251 (21%)
CSLA10NP_173818.1 CESA_CaSu_A2 122..358 CDD:133059 53/252 (21%)
Glyco_tranf_2_3 122..357 CDD:290369 53/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.