DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLC5

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_194887.1 Gene:CSLC5 / 829286 AraportID:AT4G31590 Length:692 Species:Arabidopsis thaliana


Alignment Length:299 Identity:59/299 - (19%)
Similarity:98/299 - (32%) Gaps:119/299 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYSILMPTYNEKDNLPIII---WLIVKYMK----------------ASGLEYEVI---------- 42
            |:.|::......|.|.:.:   |  :||.|                .||.||.::          
plant   177 KFCIVLFLIQSVDRLVLCLGCFW--IKYKKIKPRFDEEPFRNDDAEGSGSEYPMVLVQIPMCNER 239

  Fly    43 -----------------------VIDDGSPDG-----TLDVAKDLQKIYGEDKIVLRPR----GS 75
                                   |:||.:.:.     ..:|||..||  |.: |:.|.|    |.
plant   240 EVYEQSISAVCQLDWPKDRILVQVLDDSNDESIQQLIKAEVAKWSQK--GVN-IIYRHRLVRTGY 301

  Fly    76 KLG-----LGTAYIHGIKHATGDFIVIIDADLSHHPKF----IPEFIKLQQEGNYDIVSGTRYAG 131
            |.|     :...|:...     :::.|.|||....|.|    :|.|   :......:|...    
plant   302 KAGNLKSAMSCDYVEAY-----EYVAIFDADFQPTPDFLKLTVPHF---KDNPELGLVQAR---- 354

  Fly   132 NGGVFGWDFKRK---LISRGANF-----------LSQVLLRPNASDLTGSFRLYKKDVLEKCIAS 182
                  |.|..|   |::|..|.           ::.|.|  |.....|:..:::...||:. ..
plant   355 ------WTFVNKDENLLTRLQNINLCFHFEVEQQVNGVFL--NFFGFNGTAGVWRIKALEES-GG 410

  Fly   183 CVSKGYVFQMEMLVRARQHGY---------TIAEVPITF 212
            .:.:..|..|::.|||..||:         .:.|||.::
plant   411 WLERTTVEDMDIAVRAHLHGWKFIYLNDVKVLCEVPESY 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 59/299 (20%)
DPM1_like 10..237 CDD:133062 58/296 (20%)
CSLC5NP_194887.1 Glyco_tranf_GTA_type 227..463 CDD:416254 47/247 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.