DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLC6

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001326755.1 Gene:CSLC6 / 819921 AraportID:AT3G07330 Length:682 Species:Arabidopsis thaliana


Alignment Length:254 Identity:57/254 - (22%)
Similarity:96/254 - (37%) Gaps:86/254 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILMPTYNEKDNLPIIIWLIVKYMKASG----LEYE-----VIVIDDGSPDGTLDVAK----DLQK 61
            :.:|..|||:          .|.::.|    |::.     |.|:||.|   .|||.:    ::||
plant   225 VQIPMCNEKE----------VYQQSIGAVCMLDWPRERMLVQVLDDSS---ELDVQQLIKAEVQK 276

  Fly    62 IYGED-KIVLRPR----GSKLG-----LGTAYIHGIKHATGDFIVIIDADLSHHPKF----IPEF 112
            ..... :||.|.|    |.|.|     :...|:...     :|:.|.|||......|    :|.|
plant   277 WQQRGVRIVYRHRLIRTGYKAGNLKAAMNCEYVKDY-----EFVAIFDADFQPPADFLKKTVPHF 336

  Fly   113 IKLQQEGNYDI-VSGTRYAGNGGVFGWDFKRK---LISRGANF-----------LSQVLLRPNAS 162
                 :||.:: :..||         |.|..|   |::|..|.           ::.|.:  |..
plant   337 -----KGNEELALVQTR---------WAFVNKDENLLTRLQNINLSFHFEVEQQVNGVFI--NFF 385

  Fly   163 DLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGY---------TIAEVPITF 212
            ...|:..:::...||.| ...:.:..|..|::.|||...|:         .:.|:|.::
plant   386 GFNGTAGVWRIKALEDC-GGWLERTTVEDMDIAVRAHLCGWKFIYLNDVKCLCELPESY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 57/254 (22%)
DPM1_like 10..237 CDD:133062 57/254 (22%)
CSLC6NP_001326755.1 Glyco_tranf_GTA_type 221..457 CDD:416254 57/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.