DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and Alg5

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_079718.1 Gene:Alg5 / 66248 MGIID:1913498 Length:324 Species:Mus musculus


Alignment Length:255 Identity:71/255 - (27%)
Similarity:122/255 - (47%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PTNGHKYSILMPTYNEKDNLPIIIWLIVKYMKA-----SGLEYEVIVIDDGSPDGTLDVAKDLQK 61
            ||.  :.|:::|:|||:..||:::...:.|::.     ....|||||:||||.|.|..||....:
Mouse    63 PTK--QLSVVVPSYNEEKRLPVMMDEALNYLEKRQKHDCTFTYEVIVVDDGSEDQTSKVALKYCQ 125

  Fly    62 IYGEDKI----VLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYD 122
            .||.||:    ::|.||.    |.|...|:..:.|:.|::.|||.:  .|| |:..|| ::|..|
Mouse   126 KYGSDKVRVITLVRNRGK----GGAVRMGVFSSRGEKILMADADGA--TKF-PDVEKL-EKGLSD 182

  Fly   123 ---------IVSGTR-YAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLE 177
                     |..|:| :.....:....:.|..:..|.:||...|......|....|:|..::...
Mouse   183 LQPWPEQMAIACGSRAHLEKESIAQRSYFRTFLMYGFHFLVWFLCVKGIRDTQCGFKLLTREAAA 247

  Fly   178 KCIASCVSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYL 237
            :..:|...:.:.|.:|:|..|:.....||||.:.:.: |.|:..:.....:|..|:||::
Mouse   248 RTFSSLHIERWAFDVELLYIAQCLQIPIAEVAVNWTE-IEGSKLVPFWSWLQMGKDLLFI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 70/254 (28%)
DPM1_like 10..237 CDD:133062 68/245 (28%)
Alg5NP_079718.1 DPG_synthase 69..289 CDD:133031 64/228 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0463
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.830698 Normalized mean entropy S787
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.