DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and dpm1

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001011407.1 Gene:dpm1 / 496884 XenbaseID:XB-GENE-976623 Length:247 Species:Xenopus tropicalis


Alignment Length:238 Identity:179/238 - (75%)
Similarity:213/238 - (89%) Gaps:0/238 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NGHKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKI 68
            :|.|||:|:|||||::|||:|:||:|:..:.||..||:||||||||||||:||:.||||||.|||
 Frog    10 SGDKYSVLLPTYNERENLPLIVWLLVRCFRDSGYNYEIIVIDDGSPDGTLEVAQQLQKIYGSDKI 74

  Fly    69 VLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNG 133
            :||||..||||||||:||::||||:||:|:|||||||||||||||:.|:||:|||||||||:|||
 Frog    75 LLRPRAKKLGLGTAYVHGMQHATGNFIIIMDADLSHHPKFIPEFIRKQKEGSYDIVSGTRYSGNG 139

  Fly   134 GVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRA 198
            ||:|||.|||||||||||::||||||.|||||||||||:||||:|.:..||||||||||||:|||
 Frog   140 GVYGWDLKRKLISRGANFVTQVLLRPGASDLTGSFRLYRKDVLQKLVERCVSKGYVFQMEMIVRA 204

  Fly   199 RQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241
            ||..|||.||||:||||:||.|||||.||:.|.|.||.|||||
 Frog   205 RQLNYTIGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 177/236 (75%)
DPM1_like 10..237 CDD:133062 170/226 (75%)
dpm1NP_001011407.1 PLN02726 1..247 CDD:215385 177/236 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 287 1.000 Domainoid score I1572
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2865
Inparanoid 1 1.050 386 1.000 Inparanoid score I1981
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445102at2759
OrthoFinder 1 1.000 - - FOG0003124
OrthoInspector 1 1.000 - - oto105587
Panther 1 1.100 - - LDO PTHR43398
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4337
SonicParanoid 1 1.000 - - X2989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.