DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and wol

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609202.1 Gene:wol / 34134 FlyBaseID:FBgn0261020 Length:326 Species:Drosophila melanogaster


Alignment Length:239 Identity:61/239 - (25%)
Similarity:111/239 - (46%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SILMPTYNEKDNLPIIIWLIVKYM--KASG---LEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKI 68
            |:::|.|||:..||.::...:.::  |::|   ..|||||:.|||.|.|:.||....|.:|.:|:
  Fly    69 SVIVPAYNEEQRLPSMLDECLAFLEQKSAGTPNFTYEVIVVSDGSQDATVSVALGYSKKHGAEKV 133

  Fly    69 VLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQ-----------QEGNYD 122
            .:.......|.|.|...|:..|.|..::..|||.:  .|| |::.||:           .:|   
  Fly   134 RVLELIENRGKGGAVRMGMLSARGRNLLFADADGA--TKF-PDYDKLEVALKQLAPEWRDDG--- 192

  Fly   123 IVSGTR-YAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSK 186
            |..|:| :..|..:....|.|.::..|.:||..:....:..|....|:|:.:....|...|...:
  Fly   193 IAIGSRAHLENDAIATRSFFRTILMHGFHFLVWLFAVRSIRDTQCGFKLFTRTTARKLFTSLHVE 257

  Fly   187 GYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQF 230
            .:.|.:|:|..|......::||.:.:       :::.|:::..|
  Fly   258 RWAFDVELLYLAENLKLPMSEVAVRW-------TEIDGSKLTPF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 61/239 (26%)
DPM1_like 10..237 CDD:133062 60/238 (25%)
wolNP_609202.1 DPG_synthase 70..290 CDD:133031 59/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449656
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0463
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.