DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and Dpm1

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001100014.1 Gene:Dpm1 / 296394 RGDID:1310120 Length:260 Species:Rattus norvegicus


Alignment Length:235 Identity:172/235 - (73%)
Similarity:208/235 - (88%) Gaps:0/235 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKIVLR 71
            |||:|:|||||::|||:|:||:||....|.:.||:|:|||||||||.:||:.|:||||.|:|:||
  Rat    26 KYSVLLPTYNERENLPLIVWLLVKSFSESAINYEIIIIDDGSPDGTREVAEQLEKIYGPDRILLR 90

  Fly    72 PRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGVF 136
            ||..|||||||||||||||||::::|:|||||||||||||||:.|:|||:||||||||.|||||:
  Rat    91 PREKKLGLGTAYIHGIKHATGNYVIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVY 155

  Fly   137 GWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQH 201
            |||.|||:|||||||::|:||||.|||||||||||:|:||:|.|..||||||||||||:|||||.
  Rat   156 GWDLKRKIISRGANFITQILLRPGASDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQM 220

  Fly   202 GYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241
            .||:.||||:||||:||.|||||.||:.|.|.||.|||||
  Rat   221 DYTVGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 170/233 (73%)
DPM1_like 10..237 CDD:133062 164/226 (73%)
Dpm1NP_001100014.1 PLN02726 21..260 CDD:215385 170/233 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341374
Domainoid 1 1.000 280 1.000 Domainoid score I1610
eggNOG 1 0.900 - - E1_COG0463
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2865
Inparanoid 1 1.050 375 1.000 Inparanoid score I2027
OMA 1 1.010 - - QHG61609
OrthoDB 1 1.010 - - D1445102at2759
OrthoFinder 1 1.000 - - FOG0003124
OrthoInspector 1 1.000 - - oto98897
orthoMCL 1 0.900 - - OOG6_100818
Panther 1 1.100 - - LDO PTHR43398
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2989
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.