DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and Ugcg

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_035803.1 Gene:Ugcg / 22234 MGIID:1332243 Length:394 Species:Mus musculus


Alignment Length:243 Identity:55/243 - (22%)
Similarity:89/243 - (36%) Gaps:46/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAK---------DLQKIYG 64
            |:|.|......||   |..:..:.:....:|||::......|..:||.|         |.:...|
Mouse    54 SLLKPLKGVDPNL---INNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIG 115

  Fly    65 EDKIVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRY 129
            ..|:.:.|:.:.|      :...:.|..|.|.|.|:.:...|..:.:.:. |......:|.|..|
Mouse   116 GKKVGINPKINNL------MPAYEVAKYDLIWICDSGIRVIPDTLTDMVN-QMTEKVGLVHGLPY 173

  Fly   130 -AGNGG--------VFGWDFKRKLISRGANFLSQV-----LLRPNASDLTGSFRLYKKDVLE--- 177
             |...|        .||....|..||........|     |:|.:..|..|....:.:.:.|   
Mouse   174 VADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYF 238

  Fly   178 --KCIASCVSKGYVFQMEMLVRARQHG-YTIAEVPITFVDRIYGTSKL 222
              |.||   .:|:.|.|...|..:..| |:|::    |..|:...:||
Mouse   239 MAKAIA---DRGWRFSMSTQVAMQNSGSYSISQ----FQSRMIRWTKL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 55/243 (23%)
DPM1_like 10..237 CDD:133062 54/242 (22%)
UgcgNP_035803.1 Glucosylceramide_synthase 51..280 CDD:133012 55/243 (23%)
(Q/R)XXRW. /evidence=ECO:0000305 272..276 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.