DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hasp and Sell

DIOPT Version :9

Sequence 1:NP_001137842.2 Gene:Hasp / 35238 FlyBaseID:FBgn0032797 Length:1677 Species:Drosophila melanogaster
Sequence 2:XP_030108191.1 Gene:Sell / 20343 MGIID:98279 Length:387 Species:Mus musculus


Alignment Length:319 Identity:79/319 - (24%)
Similarity:117/319 - (36%) Gaps:97/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  1270 GSHERTCIHSE----WTNTKPVCSGLNQENDYAMEKAPTILFRHQNGP-------IAQSNDGKLI 1323
            |:|..|..:||    |.|.:..|. .|..:..|::....|.:.....|       |.....||:.
Mouse    35 GTHCWTYHYSEKPMNWENARKFCK-QNYTDLVAIQNKREIEYLENTLPKSPYYYWIGIRKIGKMW 98

  Fly  1324 VYPGT--TLHME-----------------CLWM---RRFGNPKWNVSHTHKN-----YTEGWVTE 1361
            .:.||  ||..|                 |:.:   |...:.|||....||.     ||......
Mouse    99 TWVGTNKTLTKEAENWGAGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPG 163

  Fly  1362 ADEGRD---STLEYRLSIVDAASDDSGFY--SCMTPARHEHTVEVVVRAINCPEI-------PMR 1414
            :..||.   .|:.....|.||     |:|  .|      ::.|:  ...:..||:       |: 
Mouse   164 SCNGRGECVETINNHTCICDA-----GYYGPQC------QYVVQ--CEPLEAPELGTMDCIHPL- 214

  Fly  1415 RGLIVNTNDTKLSTRALLSCANGNSLIGASELFCLPSGNWSAPLPVCESVECGDI---------- 1469
                   .:....::...:|:.|..|:|.:|..|..|||||:|.|:|:.|:|..:          
Mouse   215 -------GNFSFQSKCAFNCSEGRELLGTAETQCGASGNWSSPEPICQVVQCEPLEAPELGTMDC 272

  Fly  1470 --PLGMGSNASSPRVSVLSREVGGRAAFSCASGYGLRGPAEAICNPTGEWSAPLPTCVE 1526
              |||..|..|             :.||:|:.|..|.|.||..|..:|.||:|.|.|.|
Mouse   273 IHPLGNFSFQS-------------KCAFNCSEGRELLGTAETQCGASGNWSSPEPICQE 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HaspNP_001137842.2 PHA02927 114..360 CDD:222943
CCP 121..175 CDD:153056
CCP 180..241 CDD:153056
CCP 245..300 CDD:153056
CCP 307..361 CDD:153056
CCP 365..420 CDD:214478
PHA02927 <497..>654 CDD:222943
Sushi 515..576 CDD:278512
PHA02927 <946..1111 CDD:222943
CCP 1408..1462 CDD:153056 16/60 (27%)
CCP <1488..1525 CDD:153056 14/36 (39%)
CCP 1529..1584 CDD:153056
CCP 1587..1643 CDD:153056
SellXP_030108191.1 CLECT_selectins_like 39..157 CDD:153062 25/118 (21%)
EGF_CA 160..192 CDD:238011 9/42 (21%)
CCP 197..255 CDD:153056 16/65 (25%)
CCP 259..317 CDD:153056 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.