| Sequence 1: | NP_001137842.2 | Gene: | Hasp / 35238 | FlyBaseID: | FBgn0032797 | Length: | 1677 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_492201.1 | Gene: | C54G4.4 / 172579 | WormBaseID: | WBGene00008314 | Length: | 868 | Species: | Caenorhabditis elegans |
| Alignment Length: | 507 | Identity: | 90/507 - (17%) |
|---|---|---|---|
| Similarity: | 140/507 - (27%) | Gaps: | 222/507 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 143 ASYACPHGYHVVGLQSRLCQADGNWAGAEPACKQNIYCLKP------------------------ 183
Fly 184 -------------------------------PQIE--HARNSALPEQETFDLDSTVQYHCH---- 211
Fly 212 ----------------TGYVTNGFPRAKC-----------------LAIDNLASWYGPDIQCEPR 243
Fly 244 SC------------------------------------------------------GQP------ 248
Fly 249 ---------------PDPAYGWHAGEC------------------------YTYGCKITYNCGTG 274
Fly 275 YELVGKHERYCQSDGSWTPKELPTCVLVTSVVCPTPENPKNG--KATYTTLAYNSVVSYECRYGY 337
Fly 338 TLVGESSSR-------CGADRKWSGTLPTCKEINCGHPGVLYNGWIENIEAGTGLGASIIFRCQP 395
Fly 396 EMMINGLGSSVCQIDGRWRNALPECLAPCVVPTISQGNVYPIEIITDENGTT 447 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Hasp | NP_001137842.2 | PHA02927 | 114..360 | CDD:222943 | 68/418 (16%) |
| CCP | 121..175 | CDD:153056 | 11/31 (35%) | ||
| CCP | 180..241 | CDD:153056 | 14/154 (9%) | ||
| CCP | 245..300 | CDD:153056 | 20/153 (13%) | ||
| CCP | 307..361 | CDD:153056 | 20/62 (32%) | ||
| CCP | 365..420 | CDD:214478 | 15/54 (28%) | ||
| PHA02927 | <497..>654 | CDD:222943 | |||
| Sushi | 515..576 | CDD:278512 | |||
| PHA02927 | <946..1111 | CDD:222943 | |||
| CCP | 1408..1462 | CDD:153056 | |||
| CCP | <1488..1525 | CDD:153056 | |||
| CCP | 1529..1584 | CDD:153056 | |||
| CCP | 1587..1643 | CDD:153056 | |||
| C54G4.4 | NP_492201.1 | CCP | 161..217 | CDD:153056 | 11/30 (37%) |
| CLECT | 355..473 | CDD:214480 | 10/117 (9%) | ||
| CCP | 479..534 | CDD:153056 | 14/55 (25%) | ||
| CCP | 539..602 | CDD:153056 | 20/62 (32%) | ||
| CCP | 606..659 | CDD:153056 | 15/54 (28%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 51 | 1.000 | Domainoid score | I7777 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||