DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cyst and si:dkey-172h23.2

DIOPT Version :10

Sequence 1:NP_001260588.1 Gene:cyst / 35237 FlyBaseID:FBgn0032796 Length:1319 Species:Drosophila melanogaster
Sequence 2:NP_957093.1 Gene:si:dkey-172h23.2 / 393772 ZFINID:ZDB-GENE-141212-258 Length:221 Species:Danio rerio


Alignment Length:61 Identity:16/61 - (26%)
Similarity:25/61 - (40%) Gaps:12/61 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 IEQALLLE---------EKLMLQFNLLKEQ---QPFGDVAGTNSSCSAANFLAAFGSYKDL 860
            :|:||||:         |||.|..:|..:.   .|...:.|.|:.......|..|.:.:.|
Zfish   116 LEEALLLDEHQIPLQECEKLDLSLSLALKHLTLPPGWSLIGNNTRMDPQETLLHFAARRGL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cystNP_001260588.1 RhoGEF 447..627 CDD:214619
PH_ARHGEF2_18_like 671..774 CDD:275432
SMC_prok_B 935..>1073 CDD:274008
si:dkey-172h23.2NP_957093.1 ANKYR <158..>218 CDD:440430 4/19 (21%)
ANK repeat 163..197 CDD:293786 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.