DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and DCP2

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_014281.1 Gene:DCP2 / 855605 SGDID:S000005062 Length:970 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:41/184 - (22%)
Similarity:65/184 - (35%) Gaps:67/184 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQ--LKMCRH--------N 83
            ::.::||.|..:...|             |:.|    |..|..|:..:  |:|.|:        |
Yeast   701 KVKILKRGETFASLAN-------------DKKA----FDSSSNVSSSKDLLQMLRNPISSTVSSN 748

  Fly    84 QDSPRPEFLSGGDHISRDIALRLTALRETFEE---------------VGILICTEQD-------- 125
            |.||:.:.|||.:.|...:.....:..:..||               :|:|...|:|        
Yeast   749 QQSPKSQHLSGDEEIMMMLKRNSVSKPQNSEENASTSSINDANASELLGMLKQKEKDITAPKQPY 813

  Fly   126 ---------------DIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDASQFLEL 164
                           :|.|.:..:|:|||....|||......|  |||:...||
Yeast   814 NVDSYSQKNSAKGLLNILKKNDSTGYPRTEGGPSSEMSTSMKR--NDATNNQEL 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
DCP2NP_014281.1 DCP2 17..99 CDD:398619
Dcp2p 103..242 CDD:239644
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.