DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and YJR142W

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_012676.3 Gene:YJR142W / 853607 SGDID:S000003903 Length:342 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:40/229 - (17%)
Similarity:82/229 - (35%) Gaps:64/229 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LIVAAKEDSLEDYDYRLLLIKRTEKTSYAL-NHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQL 77
            ::|..:||.||.:.: |.::.|.:...... |:..|..|::........| |.|...|.:.:.: 
Yeast    12 VLVRTQEDDLEGFSF-LEIMDRVDPLPLDFENYKNFKEGIYYMCTHDGTK-IGFVLKFAINEME- 73

  Fly    78 KMCRHNQDSPRPEFLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLL 142
                                         |...|.|||      |.|.|      :|.|.   |.
Yeast    74 -----------------------------TVCSEIFEE------TFQLD------ESRHE---LR 94

  Fly   143 ESSEHFEWQHRVHNDASQFLELFRHYKVIPNIWSLQEWSIWRTAATANRKYDTVYYITMLDKYTR 207
            ..||.|:.::.:.:..::.:.|......:.. |..:::::|     .|:|    .|: ::::...
Yeast    95 FKSEDFDHRNNLIDQLARKMYLESSLSGVKG-WRNEKYAVW-----VNKK----PYV-LVERAVA 148

  Fly   208 NIKLLLEPHEVASAHWLSPIEAWSSSQKAIIWLP 241
            .:..::......:.:.|.|     .|:|...|:|
Yeast   149 GVLGIITYGIHINGYVLDP-----KSKKVQFWVP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
YJR142WNP_012676.3 DUF4743 <80..153 CDD:406365 18/98 (18%)
Nudix_hydrolase_3 125..315 CDD:239648 11/69 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.