DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and YSA1

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_009669.1 Gene:YSA1 / 852408 SGDID:S000000315 Length:231 Species:Saccharomyces cerevisiae


Alignment Length:43 Identity:14/43 - (32%)
Similarity:20/43 - (46%) Gaps:8/43 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLE 143
            |.|:|.|......:.:|||      .|.|:  |.|.|..:||:
Yeast    65 DSAVRTTRSSGGVDGIGIL------TILKY--KDGKPDEILLQ 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 14/43 (33%)
YSA1NP_009669.1 NUDIX_ADPRase_Nudt5 76..222 CDD:467598 10/32 (31%)

Return to query results.
Submit another query.