DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and PCD1

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_013252.1 Gene:PCD1 / 850844 SGDID:S000004141 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:64/339 - (18%)
Similarity:114/339 - (33%) Gaps:117/339 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFG--VTDEQLKMCRHNQDSPRP 89
            :.|:||.||:...........||||..|..::.       |:|..  ..:|::.: .|:.:....
Yeast    53 ELRVLLTKRSRTLRSFSGDVSFPGGKADYFQET-------FESVARREAEEEIGL-PHDPEVLHK 109

  Fly    90 EFLSGGDHISRDIALRLTALRETFEEVGILIC-TEQDDIQKWDSKSGHPRTVLL--------ESS 145
            ||....|::..|:...|:   .||..|..::| ..:|.::|.:.|...|..:..        |:|
Yeast   110 EFGMKLDNLVMDMPCYLS---RTFLSVKPMVCFLYKDKLEKHEDKYKVPLDIRKFFGKLNPGETS 171

  Fly   146 EHF-------------EWQHRVHNDASQFLELFRHYKVIPNIWSLQEWSIWRTAATANRKYDTVY 197
            ..|             |....|.:..:::.|. :.||:   .|...:|                 
Yeast   172 SLFSVPLNDLVIHLLPEADEDVKSYQAEYFER-KEYKL---NWGGIKW----------------- 215

  Fly   198 YITMLDKYTRNIKLLLEPH-EVASAH---WLSPIEAWSSSQK----------AIIW-LPFMLLYD 247
                         |::..| .||:.:   ||..||..|||.:          ..:| |...:|:|
Yeast   216 -------------LIMHYHFHVANNNEMPWLQTIEDLSSSDEDGVDGGIFRFRDLWGLTCKILFD 267

  Fly   248 IARLMNFYSFQELL-------------NFSRQRSCNGSTMVQPVYYRCDDCMFGVLPGD------ 293
            ::.:.|....::|.             ::..|...||.:          :...|::.||      
Yeast   268 VSCIANGLMDEKLKGELGHEDLIVGLHDYGNQMQPNGRS----------EWEIGMINGDRNLKYS 322

  Fly   294 ----ELYPKEPGAC 303
                |.|.|....|
Yeast   323 DVIPEYYMKHLLEC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
PCD1NP_013252.1 CoAse 38..265 CDD:239518 50/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.