DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and NUDT4

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_173266.1 Gene:NUDT4 / 838410 AraportID:AT1G18300 Length:207 Species:Arabidopsis thaliana


Alignment Length:141 Identity:34/141 - (24%)
Similarity:48/141 - (34%) Gaps:46/141 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 FLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHRVH 155
            |..||  ...|.::...|||||.||.|:....| :.:.||..||.               :|.:.
plant    98 FPKGG--WETDESMEEAALRETIEEAGVTGELE-EKLGKWQYKSK---------------RHSII 144

  Fly   156 NDASQFLELFRHYKVIPNIWSLQEWSIWRTAATANRKYDTVYYITMLDKYTRNIKLLLEPHEVAS 220
            :|...|..|..           ||:..|..|....|::      ..||          |..||..
plant   145 HDGYMFALLVS-----------QEFERWPEAEMRQRRW------VSLD----------EAREVCQ 182

  Fly   221 AHWL-SPIEAW 230
            ..|: ..:||:
plant   183 NWWMREALEAF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 34/141 (24%)
NUDT4NP_173266.1 NUDIX_DIPP2_like_Nudt4 61..193 CDD:467551 33/139 (24%)

Return to query results.
Submit another query.