DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and NUDT20

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_197447.2 Gene:NUDT20 / 832066 AraportID:AT5G19460 Length:374 Species:Arabidopsis thaliana


Alignment Length:171 Identity:33/171 - (19%)
Similarity:61/171 - (35%) Gaps:62/171 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 SQKAIIWLPFMLLYDIARLMN------FYSFQELLNFSRQRSC----NGSTMVQPVYYRCDDCM- 286
            |:|...::||::...|...::      ...|.::..||:..||    :|...:..:..:.:|.. 
plant    92 SEKLGEFIPFVIEEQIVGYIHKRFTEYLREFHDIFTFSQNGSCPDRVDGYVTLNLMLQKPEDRTR 156

  Fly   287 -----------FGVLPG--DELYPKEPGACTQTIILSGSVDDLHRKSKQY----------NRYIV 328
                       .|::||  :||||.:| :....:..|     |.|.:..|          |.|:.
plant   157 AVADVIKILGDKGIIPGIRNELYPVKP-SFNAPVFFS-----LERAAAPYFGIKGYGVHMNGYVE 215

  Fly   329 YDFHKV-------------------VLASNIP---PCDGHL 347
            .|..|:                   ::|..:|   .|.|:|
plant   216 RDGQKLLWIGKRSLSKSTYPGMLDHLVAGGLPHGISCGGNL 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 5/17 (29%)
NUDT20NP_197447.2 PLN02839 1..374 CDD:178432 33/171 (19%)

Return to query results.
Submit another query.