DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and NUDX14

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_567384.1 Gene:NUDX14 / 826805 AraportID:AT4G11980 Length:309 Species:Arabidopsis thaliana


Alignment Length:262 Identity:49/262 - (18%)
Similarity:91/262 - (34%) Gaps:91/262 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFK---------------SFGVTDEQLKMC 80
            :||:..:.....:....|...:||....|....|.|.:               ::.|..||::: 
plant   103 VLIQGVDMFGKRIGFLKFKADIFDKETGQKVPGIVFARGPAVAVLILLESDGETYAVLTEQVRV- 166

  Fly    81 RHNQDSPRP------EFLSG------GDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSK 133
                    |      |..:|      ||.:.       ||:||..||:||.:  :::|:.     
plant   167 --------PTGKIVLELPAGMLDDDKGDFVG-------TAVREVEEEIGIKL--KKEDMV----- 209

  Fly   134 SGHPRTVLLESSEHFEWQHRVHNDASQFLELFRHYKVIPNIWSL-QEWSIWRTAATANRKYDTVY 197
                                   |.:.||:....|::.|:.... :|.|::.......:  :|:.
plant   210 -----------------------DLTAFLDPSTGYRIFPSPGGCDEEMSVFLYRGQVEK--ETIR 249

  Fly   198 YI----TMLDKYTRNIKLLLEPHEVASAHWLSPIEAWSSSQKAIIWLPFMLLYDIARLMNFYSFQ 258
            .:    |.|.::...||:.|.|:.          |.|..:..|.: |..:.||::|:.....|.|
plant   250 QLQGKETGLREHGEFIKVRLIPYR----------ELWRKTADAKV-LMSIGLYEMAQREGLVSSQ 303

  Fly   259 EL 260
            .|
plant   304 RL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 46/251 (18%)
NUDX14NP_567384.1 PLN03143 3..304 CDD:215602 47/259 (18%)

Return to query results.
Submit another query.