DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and nudt8

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_021337150.1 Gene:nudt8 / 791929 ZFINID:ZDB-GENE-061013-219 Length:298 Species:Danio rerio


Alignment Length:55 Identity:21/55 - (38%)
Similarity:26/55 - (47%) Gaps:5/55 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FGVTDEQLKMCRHNQDSPRPEFLSGGDHISRDIALRLTALRETFEEVGILICTEQ 124
            |.:...||| .||..|..    .:||.....|..:..|||||..||:||.|..|:
Zfish   197 FTLRSAQLK-GRHKGDVS----FAGGKKDPSDRTVVDTALREAAEELGIHIPEEK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
nudt8XP_021337150.1 CoAse 178..>264 CDD:239518 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.