Sequence 1: | NP_001260584.1 | Gene: | CG18094 / 35232 | FlyBaseID: | FBgn0032791 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_079815.2 | Gene: | Nudt2 / 66401 | MGIID: | 1913651 | Length: | 147 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 41/202 - (20%) |
---|---|---|---|
Similarity: | 66/202 - (32%) | Gaps: | 85/202 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 ALNHC---VFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPRPEFLSGGDHISRDIA 103
Fly 104 LRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDASQ--FLELFR 166
Fly 167 ---HYKVIPNIWSLQEWSIWRTAATANRKYDTV-YYITMLDKYTRNIKLLLEPHEVASAHWLSPI 227
Fly 228 EAWSSSQ 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18094 | NP_001260584.1 | None | |||
Nudt2 | NP_079815.2 | Ap4A_hydrolase_human_like | 2..140 | CDD:239520 | 41/202 (20%) |
Nudix box | 43..64 | 9/27 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0494 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |