DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and Nudt3

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_062811.1 Gene:Nudt3 / 56409 MGIID:1928484 Length:168 Species:Mus musculus


Alignment Length:205 Identity:36/205 - (17%)
Similarity:61/205 - (29%) Gaps:75/205 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YRPSASLIVAAKEDSLEDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGV 72
            |:..|:.:....|...|     :||:    .:|...:..:.|||..:|.|:.|            
Mouse    17 YKKRAACLCFRSESEEE-----VLLV----SSSRHPDRWIVPGGGMEPEEEPS------------ 60

  Fly    73 TDEQLKMCRHNQDSPRPEFLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHP 137
                                             :.|:||..||.|:              |....
Mouse    61 ---------------------------------VAAVREVCEEAGV--------------KGTLG 78

  Fly   138 RTV-LLESSEHFEWQHRVHNDASQFLELFRHYKVIPNIWSLQEWSIWRTA---ATANRKYDTVYY 198
            |.| :.|:.|.   :||.:.......|:...::...||...:||.....|   ...::.....|:
Mouse    79 RLVGIFENQER---KHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQCHKPVQASYF 140

  Fly   199 ITMLDKYTRN 208
            .|:...|..|
Mouse   141 ETLRQGYPAN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 35/203 (17%)
Nudt3NP_062811.1 NUDIX_DIPP2_like_Nudt4 19..143 CDD:467551 32/194 (16%)
Nudix box 51..72 9/65 (14%)

Return to query results.
Submit another query.