DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and NUDT1

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_945187.1 Gene:NUDT1 / 4521 HGNCID:8048 Length:179 Species:Homo sapiens


Alignment Length:130 Identity:27/130 - (20%)
Similarity:44/130 - (33%) Gaps:47/130 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 YRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPRPEFL 92
            |.|:|:.:.::....:....|..|          :|    ..||...::.:..   :|..|.|  
Human    30 YTLVLVLQPQRVLLGMKKRGFGAG----------RW----NGFGGKVQEGETI---EDGARRE-- 75

  Fly    93 SGGDHISRDIALRLTALRE----TFEEVG-------ILICTEQDDIQKWDSKSGHPRTVLLESSE 146
                 :..:..|.:.||.:    .||.||       .:.||        ||..|.|    :||.|
Human    76 -----LQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCT--------DSIQGTP----VESDE 123

  Fly   147  146
            Human   124  123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
NUDT1NP_945187.1 MTH1 29..163 CDD:239519 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.