DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and nudt3b

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017211962.1 Gene:nudt3b / 450013 ZFINID:ZDB-GENE-041010-128 Length:187 Species:Danio rerio


Alignment Length:163 Identity:27/163 - (16%)
Similarity:47/163 - (28%) Gaps:77/163 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPRP 89
            |.:..:||:    .:|...:..:.|||..:|.|:.:                             
Zfish    29 DTEQEVLLV----SSSRHPDKWIVPGGGMEPEEEPN----------------------------- 60

  Fly    90 EFLSGGDHISRDIALRLTALRETFEEVG------------------------ILICTEQDDIQKW 130
                            :.|.||..||.|                        :||.||.  ::.|
Zfish    61 ----------------VAAAREVCEEAGVKGTLGRLVGIFENRDRKHRTYVYVLIVTEV--LEDW 107

  Fly   131 DSKSGHPRTVLLESSEHFEWQHRVHNDASQFLE 163
            :......::..|......|| .:: :||.|.|:
Zfish   108 EDSVNIGKSSGLGFGRKREW-FKI-DDAIQVLQ 138



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.