DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and nudt19

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001004903.1 Gene:nudt19 / 448257 XenbaseID:XB-GENE-5839199 Length:380 Species:Xenopus tropicalis


Alignment Length:395 Identity:124/395 - (31%)
Similarity:195/395 - (49%) Gaps:67/395 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YRPSASLIVAAK----------------EDSLEDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPI 56
            ::.:|:||:||:                ......:||.:||:||::|:.:..|..|||||..:| 
 Frog     8 WKEAATLILAARTSHGNLPYIQQQARVQNHQNNTFDYEVLLLKRSQKSGFMPNAFVFPGGNVEP- 71

  Fly    57 EDQSAKWITFFK------SFGVTDEQLKMCRHNQDSP-----RPEFLSGGDHISRDIALRLTALR 110
            .|.|:.||..|.      :||:.    .:.:|:..||     |.:|   |..|..::|.|:.|:|
 Frog    72 SDFSSDWIKVFSRYEQKPNFGLG----LVKQHDNRSPMFTTDRSKF---GSLIPGEVATRICAIR 129

  Fly   111 ETFEEVGILICTEQ----DDIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDASQFLELFRHYKVI 171
            |||||.|||:...:    :|.|.....:.|      :..|..:|:..|..:.|||:::.|..:.:
 Frog   130 ETFEESGILLVVPENFNSEDNQNLIDITDH------DKEEISKWRQEVQRNPSQFIQMCRMMRCM 188

  Fly   172 PNIWSLQEWSIWRTAATA----NRKYDTVYYITMLDKYTRNIKLLL--EPHEVASAHWLSPIEAW 230
            ||||:|:|||.|.|...:    :|::||.::|..|     |.|..:  :..||.|..|.:|:||.
 Frog   189 PNIWALKEWSNWLTPVFSQGLKSRRFDTAFFICCL-----NAKPAVSDDKKEVTSFKWWTPVEAL 248

  Fly   231 SSSQKAIIWLPFMLLYDIARLMNFYSFQELLNFSRQRSCNGSTMVQPVYYRCDDCMFGVLPGDEL 295
            ...:...||:|....|:|:||.:|....||..|...||..|.....||..:|:|.:...||||:|
 Frog   249 EDYKCHKIWIPPPQFYEISRLCHFAPINELHKFIISRSLEGCEQWMPVIAQCEDGIVHTLPGDDL 313

  Fly   296 YPKEPGAC--TQTIILSG-SVDDLHRKSKQYNRYIVYDFHKVVLASNIPPCDGHLPLQPLV---- 353
            ||:||...  .||::.|. ::.:|.:|...::|.:|.|....:|. ||.|...|  :.||.    
 Frog   314 YPEEPDLTGEKQTVVCSNETIQNLVQKGGCFHRVVVIDGTPTLLV-NIKPKYKH--INPLTTELQ 375

  Fly   354 -NNKL 357
             .|||
 Frog   376 SKNKL 380



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm47955
Panther 1 1.100 - - O PTHR12318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.030

Return to query results.
Submit another query.