DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and nudt2

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001002323.1 Gene:nudt2 / 436595 ZFINID:ZDB-GENE-040718-7 Length:147 Species:Danio rerio


Alignment Length:181 Identity:37/181 - (20%)
Similarity:59/181 - (32%) Gaps:87/181 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSLEDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQD 85
            |::|     .||:    :|||..:|...|.|..||.||                           
Zfish    21 DNIE-----FLLL----QTSYGEHHWTPPKGHVDPGED--------------------------- 49

  Fly    86 SPRPEFLSGGDHISRDIALRLTALRETFEEVGI-----------------LICTEQDDIQKWDSK 133
                           |:.   ||||||.||.|:                 .:..:..::..|.::
Zfish    50 ---------------DLT---TALRETQEEAGLGKDHLRVVDGFLQRLHYQVRGKDKEVVYWLAE 96

  Fly   134 SGHPRTVLLESSEH--FEW----------QHRVHND----ASQFLELFRHY 168
            ..:|.|.::.|.||  :.|          |::...|    |.::||..|.:
Zfish    97 LRNPNTQVILSDEHQDYRWAKLEEACKLAQYQDLQDTLTAAQRYLETNRKH 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
nudt2NP_001002323.1 Ap4A_hydrolase_human_like 2..139 CDD:239520 34/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.