DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and DCP2

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster


Alignment Length:224 Identity:40/224 - (17%)
Similarity:67/224 - (29%) Gaps:114/224 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPR 88
            ||:::.||:     ::.:|.|...||.|..:..||.:                            
  Fly   320 EDHNHCLLV-----QSYFARNSWGFPKGKINENEDPA---------------------------- 351

  Fly    89 PEFLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHR 153
                    |         .|.||.:||.|.       ||           |.|:           
  Fly   352 --------H---------CATREVYEETGF-------DI-----------TDLI----------- 370

  Fly   154 VHNDASQFLELFRHYK-----VIPNI-WSLQ------------EW--------------SIWRTA 186
               ||:.::|.|.:|:     |:.|| ...|            :|              |..:..
  Fly   371 ---DANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLG 432

  Fly   187 ATANRKYDTVYYITMLDKYTRNIKLLLEP 215
            .|:|..:..:.::..|.|:..:.|..:||
  Fly   433 KTSNSFFMIMPFVKRLKKWVNDRKAGIEP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 40/224 (18%)
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 38/219 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.