DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and NUDT19

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001099040.1 Gene:NUDT19 / 390916 HGNCID:32036 Length:375 Species:Homo sapiens


Alignment Length:397 Identity:109/397 - (27%)
Similarity:156/397 - (39%) Gaps:103/397 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YRPSASLIVAAKEDSLED----------YDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAK 62
            :|.:||:::||.....|.          ..:||||::|:....:.....||.|||.| ..|:||.
Human    12 WRRAASIVLAAGWSRPETATPPSRPPPAEGFRLLLLQRSPHQGFMPGAHVFSGGVLD-AADRSAD 75

  Fly    63 WI---------------------TFFKSFGVTDEQLKMCRHNQDS--PRPEFLSGGDHISRDIAL 104
            |:                     |.|.|...||:      |..|:  ..||          |:|.
Human    76 WLGLFAPHHGPPRFGLGPAPFSRTAFPSLPDTDD------HKTDNTGTLPE----------DVAF 124

  Fly   105 RLTALRETFEEVGILICTEQDDIQKWDSKSGHPRT----------VLLESSEHF-EWQHRVHNDA 158
            |:.|:||.|||.|:|:.              .|||          :.||..... .|:.||..|.
Human   125 RICAVREAFEEAGVLLL--------------RPRTSPPGPAPGPGLALEPPPGLASWRDRVRQDP 175

  Fly   159 SQFLELFRHYKVIPNIWSLQEWSIWRT--AATANRKYDTVYYITMLDKYTRNIKLLLEP------ 215
            ..||.|..|....|:||:|..||.|.|  .....|::||.:::.          .|.||      
Human   176 RHFLRLCAHLDCTPDIWALHNWSAWLTPFLRGTTRRFDTAFFLC----------CLREPPPVYPD 230

  Fly   216 -HEVASAHWLSPIEAWSSSQKAIIWLPFMLLYDIARLMNFYSFQELLNFSRQRSCNGSTMVQPVY 279
             .||....|.||.||..|.....||||....|::.||.||.|..:|..|...|:..|.....|:.
Human   231 LAEVVGYQWSSPSEATESFLSKEIWLPPPQFYEVRRLANFASLSDLHKFCLGRALEGLERWLPII 295

  Fly   280 YRCDDCMFGVLPGDELYPKEPGACTQTIILSGSVDDLHRKSKQYNRYIVYDFHKVVLASNIPPCD 344
            ....|.|..:|||||||.::.......:......:::.::.||::|.:.|..|..         |
Human   296 LLTADGMVHLLPGDELYLEDSDFLENLMSTEKKTEEIMKEGKQFHRIVTYHRHLY---------D 351

  Fly   345 GHLPLQP 351
            .|:.:||
Human   352 IHVTVQP 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
NUDT19NP_001099040.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..116 7/30 (23%)
Nudix box 116..137 11/30 (37%)
Microbody targeting signal. /evidence=ECO:0000255 373..375
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm40770
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - O PTHR12318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.720

Return to query results.
Submit another query.