powered by:
Protein Alignment CG18094 and Nudt7
DIOPT Version :9
Sequence 1: | NP_001260584.1 |
Gene: | CG18094 / 35232 |
FlyBaseID: | FBgn0032791 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038953791.1 |
Gene: | Nudt7 / 361413 |
RGDID: | 1306719 |
Length: | 285 |
Species: | Rattus norvegicus |
Alignment Length: | 90 |
Identity: | 22/90 - (24%) |
Similarity: | 28/90 - (31%) |
Gaps: | 46/90 - (51%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 LLLIKRTEKTSYALNHCVFPGGVFDPIE-DQSAKWITFFKSFGVTDEQLKMCRHNQDSPRPEFLS 93
||...|::|...|.....||||..||:: |.:|
Rat 79 LLFTVRSDKLRRAPGEVCFPGGKRDPVDADDTA-------------------------------- 111
Fly 94 GGDHISRDIALRLTALRETFEEVGI 118
|||||..||||:
Rat 112 -------------TALREAQEEVGL 123
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18094 | NP_001260584.1 |
None |
Nudt7 | XP_038953791.1 |
CoAse |
65..241 |
CDD:239518 |
22/90 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.