DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and CG12567

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001015384.1 Gene:CG12567 / 3355094 FlyBaseID:FBgn0039958 Length:349 Species:Drosophila melanogaster


Alignment Length:89 Identity:24/89 - (26%)
Similarity:36/89 - (40%) Gaps:31/89 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 ISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDASQFL 162
            |..|:...|    |.:.||..:...||       :|.|     |:|.:..|    |.:|:.::.|
  Fly    44 IKSDVLKHL----EKYPEVFCIRACEQ-------TKQG-----LVELNPAF----RDYNERTEQL 88

  Fly   163 ELFRHYKVIPNIWS------LQEW 180
            |     ||:.|:.|      ||.|
  Fly    89 E-----KVLRNLRSEGLFPALQGW 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
CG12567NP_001015384.1 DUF4743 11..136 CDD:292538 24/89 (27%)
Nudix_hydrolase_3 106..283 CDD:239648 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.