DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and ndx-2

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_503726.1 Gene:ndx-2 / 189126 WormBaseID:WBGene00003579 Length:223 Species:Caenorhabditis elegans


Alignment Length:57 Identity:14/57 - (24%)
Similarity:25/57 - (43%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EVGILICTEQDDIQKWDSKSGHPRTVLLE-SSEHFEWQHRVHNDASQFLELFRHYKV 170
            :||....|.|  :..|  :|.|..|..:| |::......||......::.|.:.|::
 Worm    47 QVGFKTHTGQ--VGVW--QSVHRNTKPVEASADGVSIIARVRKQGKLYIVLVKQYRI 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 14/57 (25%)
ndx-2NP_503726.1 NUDIX_ADPRase_Nudt5 74..219 CDD:467598 4/26 (15%)

Return to query results.
Submit another query.