powered by:
Protein Alignment CG18094 and ndx-2
DIOPT Version :9
Sequence 1: | NP_001260584.1 |
Gene: | CG18094 / 35232 |
FlyBaseID: | FBgn0032791 |
Length: | 360 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_503726.1 |
Gene: | ndx-2 / 189126 |
WormBaseID: | WBGene00003579 |
Length: | 223 |
Species: | Caenorhabditis elegans |
Alignment Length: | 57 |
Identity: | 14/57 - (24%) |
Similarity: | 25/57 - (43%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 115 EVGILICTEQDDIQKWDSKSGHPRTVLLE-SSEHFEWQHRVHNDASQFLELFRHYKV 170
:||....|.| :..| :|.|..|..:| |::......||......::.|.:.|::
Worm 47 QVGFKTHTGQ--VGVW--QSVHRNTKPVEASADGVSIIARVRKQGKLYIVLVKQYRI 99
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG18094 | NP_001260584.1 |
None |
ndx-2 | NP_503726.1 |
ADPRase_NUDT5 |
75..221 |
CDD:239516 |
4/25 (16%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.