DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and ndx-7

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_491336.2 Gene:ndx-7 / 183413 WormBaseID:WBGene00003584 Length:295 Species:Caenorhabditis elegans


Alignment Length:303 Identity:71/303 - (23%)
Similarity:120/303 - (39%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGTYRPSASLIVAAKEDSLEDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKS 69
            |.::|.:||:|:|.|...      |:|::||.....:..|..||||||.|.              
 Worm     7 TSSWRSAASIILACKTTR------RVLMLKRGTTAKFMPNTMVFPGGVVDK-------------- 51

  Fly    70 FGVTDEQLKMCRHNQDSPRPEFLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKS 134
               ||.:|                 ||.      .|:.|:||.|||.|:| .|:..    |.:.:
 Worm    52 ---TDAKL-----------------GDE------FRIAAVRELFEESGVL-STKNG----WQTSA 85

  Fly   135 GHPRTVLLESSEHFEWQHRVHNDASQFLELFRHYKVIPNIWSLQEWSIWRTAATANRKYDTVYYI 199
            .:|....|::.        :.||.|:|.:|  ...:..:  :|.||..:.|.|...|::.|.:|:
 Worm    86 NNPDMTSLKAD--------IVNDTSKFEQL--SGTICAD--NLIEWDTFITPANYPRRFLTKFYL 138

  Fly   200 TMLDKYTRNIKLLLEP------HEVASAHWLSPIEAWSSSQKAIIWLPFMLLYDIARL--MNFYS 256
            .::|.         ||      .|::..:|:.|.|....:......||...:|::.||  :..:.
 Worm   139 MLVDD---------EPAIDLCTSEMSEYNWIEPKECVDEAYAGKYALPPPQVYELTRLSQVKDWD 194

  Fly   257 FQELLNFSRQRSCNGSTMVQPVYYRCDDCMFGVLPGDELYPKE 299
            ..|.....::..|     .||:....::.:....|||.:|..|
 Worm   195 LCEKYGNVKKPIC-----PQPIKTIGENLITNCFPGDYMYIDE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
ndx-7NP_491336.2 NUDIX 10..173 CDD:278710 56/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165827
Domainoid 1 1.000 59 1.000 Domainoid score I7060
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3805
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm14788
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - O PTHR12318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.