DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and Nudt1

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001343512.1 Gene:Nudt1 / 17766 MGIID:109280 Length:156 Species:Mus musculus


Alignment Length:116 Identity:25/116 - (21%)
Similarity:39/116 - (33%) Gaps:26/116 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSE----HFEWQHRVHNDASQFLELFRHY 168
            |.||..||.|:.:.|..        |.||.....:.|.|    |......||...::..|:...:
Mouse    49 AKRELLEESGLSVDTLH--------KVGHISFEFVGSPELMDVHIFSADHVHGTPTESEEMRPQW 105

  Fly   169 KVIPNIWSLQEW---SIWRTAATANRKY---------DTV--YYITMLDKY 205
            ..:..|.....|   |.|.......:|:         ||:  |.:..:|.:
Mouse   106 FQLDQIPFADLWPDDSYWFPLLLQKKKFCGHFKFQDQDTILSYSLREVDSF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
Nudt1NP_001343512.1 MTH1 6..140 CDD:239519 21/98 (21%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 35..38
Nudix box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00794 37..58 5/8 (63%)
Substrate binding. /evidence=ECO:0000269|PubMed:29281266, ECO:0007744|PDB:5MZE 117..120 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.