DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and ndx-3

DIOPT Version :9

Sequence 1:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001380056.1 Gene:ndx-3 / 173857 WormBaseID:WBGene00003580 Length:240 Species:Caenorhabditis elegans


Alignment Length:248 Identity:47/248 - (18%)
Similarity:83/248 - (33%) Gaps:90/248 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPRPEFLSG 94
            :||.||:...........||||..||.|              .|.|                   
 Worm    68 VLLTKRSIHLRSHRGEVCFPGGRMDPGE--------------TTTE------------------- 99

  Fly    95 GDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDAS 159
                        |||||||||:|:    ..:.::.|    ||.::|:...::             
 Worm   100 ------------TALRETFEEIGV----NAESVEIW----GHLKSVIRRQAD------------- 131

  Fly   160 QFLELFRHYKVIPNIWSLQEWSIWRTAATANRKYDTVYYITM--------LDKY-TRNIKLLLEP 215
                    :.|.|.:..:.:..:.......:.:...|:.|.:        |.|: ::.:|..|..
 Worm   132 --------FNVTPIVGYISDERVLENLVVNSDEVQAVFTIPIDELIKKAGLTKFQSKRMKYTLPS 188

  Fly   216 HEVA--SAHWLSPIEAWSSSQKAIIW-LPFMLLYDIARLMN--FYSFQELLNF 263
            .:..  ..|..:|.|...|:|:  :| |..::|:....|:|  .|....::.|
 Worm   189 FDSTEFKVHHNAPNEYLHSTQR--VWGLSGVMLHQALTLLNPDVYKHDLIVKF 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_001260584.1 None
ndx-3NP_001380056.1 CoAse 54..221 CDD:239518 43/228 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.