DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and LOC1273983

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313042.4 Gene:LOC1273983 / 1273983 VectorBaseID:AGAMI1_003442 Length:248 Species:Anopheles gambiae


Alignment Length:103 Identity:27/103 - (26%)
Similarity:41/103 - (39%) Gaps:30/103 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SLIVAAKEDSLEDYDYRLLLIKRTEK---------TSYALNHCVFPGGVFDPIEDQSAKWITFFK 68
            |.|..|:|:.||:..|. :.::|.|:         ||.| ...:|...|.|  ||:.|.     .
Mosquito   143 STIEIAREEVLEECGYD-IPVERIEEIIRYRSGVGTSGA-EQTLFYAEVTD--EDKIAS-----A 198

  Fly    69 SFGVTDEQLKMCRHNQDSPR------------PEFLSG 94
            ..||.||.:.:..::.:..|            |.||.|
Mosquito   199 GGGVDDEIIDVVEYDLEEARKLTDKGTVITSPPSFLFG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 27/103 (26%)
LOC1273983XP_313042.4 NUDIX_UGPPase_Nudt14 63..244 CDD:467597 27/103 (26%)

Return to query results.
Submit another query.