DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18094 and DCP2

DIOPT Version :10

Sequence 1:NP_609974.3 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309532.5 Gene:DCP2 / 1270811 VectorBaseID:AGAMI1_002846 Length:532 Species:Anopheles gambiae


Alignment Length:144 Identity:33/144 - (22%)
Similarity:53/144 - (36%) Gaps:51/144 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHRVHNDASQFLELFRHYKVIP 172
            |:||.:||.|.       ||:|           |:..:|:.|   .:.|  .||..|:    ::|
Mosquito   167 AIREVYEETGY-------DIRK-----------LIRPTEYIE---VIVN--YQFTRLY----LVP 204

  Fly   173 -------------NIWSLQEWSIWRTAATANRKYDTVYYITMLDKY--TRNIKLLLEPHEVASAH 222
                         |.....||  :........|:|::    :.|.:  |.|...::.|.......
Mosquito   205 GVPLATVFVPKTRNEIKCCEW--FPVDVLPVTKHDSI----VKDNHNLTGNSFFMILPFVKRLKR 263

  Fly   223 WLSPIEAWSSSQKA 236
            ||   |::||..||
Mosquito   264 WL---ESFSSGGKA 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18094NP_609974.3 NUDIX_Hydrolase 10..251 CDD:469772 33/144 (23%)
DCP2XP_309532.5 None

Return to query results.
Submit another query.