powered by:
Protein Alignment CG10194 and YSA1
DIOPT Version :9
Sequence 1: | NP_609973.1 |
Gene: | CG10194 / 35231 |
FlyBaseID: | FBgn0032790 |
Length: | 351 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009669.1 |
Gene: | YSA1 / 852408 |
SGDID: | S000000315 |
Length: | 231 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 66 |
Identity: | 18/66 - (27%) |
Similarity: | 28/66 - (42%) |
Gaps: | 16/66 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 VWSLHEWSVWRTPSTFKKRFETAFFMTALEQEPRVHIEPNEVKDSAWRSPLDYLQASLRKELWLP 236
|.||:...::||.||.|.:.|.|..:.|. |:: |..|..| ..|:|.::..
Yeast 8 VISLNSRRLFRTMSTVKGKPEDAKIIEAR------HVK--ETSDCKW--------IGLQKIIYKD 56
Fly 237 P 237
|
Yeast 57 P 57
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10194 | NP_609973.1 |
None |
YSA1 | NP_009669.1 |
ADPRase_NUDT5 |
76..213 |
CDD:239516 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.