DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and PCD1

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_013252.1 Gene:PCD1 / 850844 SGDID:S000004141 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:55/280 - (19%)
Similarity:88/280 - (31%) Gaps:110/280 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SRLLPKIRSSSSLILL---AKNQVEKSTSCDYNALLLTRTQKS--TFMPESSVFPGGVCDASDSS 61
            |.:.|..|:|:.:|||   .|.::.         :|||:..::  :|..:.| ||||..|     
Yeast    31 SSIWPFKRNSAVIILLFIGMKGELR---------VLLTKRSRTLRSFSGDVS-FPGGKAD----- 80

  Fly    62 PAWLEHFQRNEFSAAKLRNVGHVKGPR-PDIFH----TKADKKSLDPSLALRLTAIR-------- 113
                 :||....|.|:......:..|. |::.|    .|.|...:|....|..|.:.        
Yeast    81 -----YFQETFESVARREAEEEIGLPHDPEVLHKEFGMKLDNLVMDMPCYLSRTFLSVKPMVCFL 140

  Fly   114 -----ETFEE-----------LGILLCRDSKSLTS-----------------TSDYGAFYDQFDR 145
                 |..|:           .|.|...::.||.|                 ...|.|.|  |:|
Yeast   141 YKDKLEKHEDKYKVPLDIRKFFGKLNPGETSSLFSVPLNDLVIHLLPEADEDVKSYQAEY--FER 203

  Fly   146 AHWQ---------------HIVHNNASQFLELCKQLDV------------LPDVWSLHEWSVWRT 183
            ..::               |:.:||...:|:..:.|..            ..|:|.|        
Yeast   204 KEYKLNWGGIKWLIMHYHFHVANNNEMPWLQTIEDLSSSDEDGVDGGIFRFRDLWGL-------- 260

  Fly   184 PSTFKKRFETAFFMTALEQE 203
              |.|..|:.:.....|..|
Yeast   261 --TCKILFDVSCIANGLMDE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
PCD1NP_013252.1 CoAse 38..265 CDD:239518 50/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.