DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and NUDT12

DIOPT Version :10

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_563919.1 Gene:NUDT12 / 837845 AraportID:AT1G12880 Length:203 Species:Arabidopsis thaliana


Alignment Length:135 Identity:29/135 - (21%)
Similarity:47/135 - (34%) Gaps:54/135 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AIRETFEELGIL-LCRD---------SKS-----------------LTSTSDYGAFYDQFDR-AH 147
            |.||..||.|:. :.|:         |||                 |..|.:...:.::.:| ..
plant    78 ASREAIEEAGVKGILRELPLGVWEFRSKSSTVEDECLGGCKGYMFALKVTEELEDWPERKNRERR 142

  Fly   148 WQHIVHNNASQFLELCKQLDVLPDVWSLHEWSVWRTPSTFKKRFETAFFMTALEQEPRVHIEPNE 212
            |..:     .:.||||:           :||        .::..|.  |:..:|.|.|:..|...
plant   143 WLTV-----KEALELCR-----------YEW--------MQRALEE--FLRVMEDERRLRTEEET 181

  Fly   213 VKDSA 217
            |.||:
plant   182 VHDSS 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 NUDIX_AcylCoAdiphos_Nudt19 11..245 CDD:467582 29/135 (21%)
NUDT12NP_563919.1 NUDIX_DIPP2_like_Nudt4 21..165 CDD:467551 21/112 (19%)

Return to query results.
Submit another query.