Sequence 1: | NP_609973.1 | Gene: | CG10194 / 35231 | FlyBaseID: | FBgn0032790 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021337150.1 | Gene: | nudt8 / 791929 | ZFINID: | ZDB-GENE-061013-219 | Length: | 298 | Species: | Danio rerio |
Alignment Length: | 267 | Identity: | 54/267 - (20%) |
---|---|---|---|
Similarity: | 72/267 - (26%) | Gaps: | 122/267 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 SRLLPKIRSSSSLILLAKNQVEKSTSCDYNALLLTRTQKSTFMPESSV--FPGGVCDASDSSPAW 64
Fly 65 L--------EHFQR---NEFSAAKLRNVGHV-KGPRPDIF-------HTKAD------------- 97
Fly 98 KKSL--------------------------DPSLALRL--------------------------- 109
Fly 110 --TAIRETFEELGILLCRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDV 172
Fly 173 WSLHEWS 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10194 | NP_609973.1 | None | |||
nudt8 | XP_021337150.1 | CoAse | 178..>264 | CDD:239518 | 18/113 (16%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0494 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |