powered by:
Protein Alignment CG10194 and Nudt8
DIOPT Version :9
Sequence 1: | NP_609973.1 |
Gene: | CG10194 / 35231 |
FlyBaseID: | FBgn0032790 |
Length: | 351 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_079805.1 |
Gene: | Nudt8 / 66387 |
MGIID: | 1913637 |
Length: | 210 |
Species: | Mus musculus |
Alignment Length: | 116 |
Identity: | 27/116 - (23%) |
Similarity: | 38/116 - (32%) |
Gaps: | 54/116 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 ALLLT-RTQKSTFMPESSV-FPGGVCDASDSSPAWLEHFQRNEFSAAKLRNVGHVKGPRPDIFHT 94
|||.| |:.:.....:..| ||||.||..|. |:.|
Mouse 46 ALLYTLRSSRLVGRHKGEVSFPGGKCDPDDQ-----------------------------DVIH- 80
Fly 95 KADKKSLDPSLALRLTAIRETFEELGILLCRDSKSLTSTSDYGAFYDQFDR 145
||:|||.||||:.:.::.. :|.....:||
Mouse 81 ---------------TALRETQEELGLEVPKEHV-------WGVLQPVYDR 109
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10194 | NP_609973.1 |
None |
Nudt8 | NP_079805.1 |
CoAse |
31..186 |
CDD:239518 |
27/116 (23%) |
Nudix box |
70..91 |
|
12/65 (18%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.