DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and nudt14

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001038353.1 Gene:nudt14 / 559149 ZFINID:ZDB-GENE-041014-254 Length:242 Species:Danio rerio


Alignment Length:71 Identity:14/71 - (19%)
Similarity:27/71 - (38%) Gaps:13/71 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 RAHWQHIVHNNASQFLELCKQLDVLPDVWSLHEWSVWRTPS---TFKKRFETAFFMTALEQEPRV 206
            |.|:.......:..|::....:.||          ::.|.|   ...|:|..|.:|:..|:....
Zfish    22 RVHYNQNGTKKSWDFMQTHDSVSVL----------IFNTTSHCFILVKQFRPAVYMSEWERSKPK 76

  Fly   207 HIEPNE 212
            .::|.|
Zfish    77 PLQPAE 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
nudt14NP_001038353.1 TIGR00052 11..229 CDD:129162 14/71 (20%)
ADPRase_NUDT5 39..231 CDD:239516 11/54 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.