DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and nudt19

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001004903.1 Gene:nudt19 / 448257 XenbaseID:XB-GENE-5839199 Length:380 Species:Xenopus tropicalis


Alignment Length:346 Identity:124/346 - (35%)
Similarity:190/346 - (54%) Gaps:43/346 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRLLPKIRSSSSLILLAKN--------------QVEKSTSCDYNALLLTRTQKSTFMPESSVFP 51
            |:..|...:.:::|||.|:.              |..::.:.||..|||.|:|||.|||.:.|||
 Frog     1 MNNTLKHWKEAATLILAARTSHGNLPYIQQQARVQNHQNNTFDYEVLLLKRSQKSGFMPNAFVFP 65

  Fly    52 GGVCDASDSSPAWLEHFQRNE----FSAAKLRNVGHVK--GPRPDIFHTKADK-KSLDP-SLALR 108
            ||..:.||.|..|::.|.|.|    |      .:|.||  ..|..:|.|...| .||.| .:|.|
 Frog    66 GGNVEPSDFSSDWIKVFSRYEQKPNF------GLGLVKQHDNRSPMFTTDRSKFGSLIPGEVATR 124

  Fly   109 LTAIRETFEELGILL-------CRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQL 166
            :.||||||||.||||       ..|:::|...:|    :|:.:.:.|:..|..|.|||:::|:.:
 Frog   125 ICAIRETFEESGILLVVPENFNSEDNQNLIDITD----HDKEEISKWRQEVQRNPSQFIQMCRMM 185

  Fly   167 DVLPDVWSLHEWSVWRTP----STFKKRFETAFFMTALEQEPRVHIEPNEVKDSAWRSPLDYLQA 227
            ..:|::|:|.|||.|.||    ....:||:||||:..|..:|.|..:..||....|.:|::.|:.
 Frog   186 RCMPNIWALKEWSNWLTPVFSQGLKSRRFDTAFFICCLNAKPAVSDDKKEVTSFKWWTPVEALED 250

  Fly   228 SLRKELWLPPPQFYELSRCLNFSSLDNLRQFAAEREVKGIQLIHPVVHKCTNGLVHLLPGDDAYP 292
            ....::|:|||||||:||..:|:.::.|.:|...|.::|.:...||:.:|.:|:||.|||||.||
 Frog   251 YKCHKIWIPPPQFYEISRLCHFAPINELHKFIISRSLEGCEQWMPVIAQCEDGIVHTLPGDDLYP 315

  Fly   293 ADPDASNEKIEIDLSVEEFRS 313
            .:||.:.||..:..|.|..::
 Frog   316 EEPDLTGEKQTVVCSNETIQN 336



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2847
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13211
Inparanoid 1 1.050 206 1.000 Inparanoid score I3620
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm47955
Panther 1 1.100 - - LDO PTHR12318
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2673
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.