powered by:
Protein Alignment CG10194 and CG42813
DIOPT Version :9
Sequence 1: | NP_609973.1 |
Gene: | CG10194 / 35231 |
FlyBaseID: | FBgn0032790 |
Length: | 351 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303547.1 |
Gene: | CG42813 / 43276 |
FlyBaseID: | FBgn0261995 |
Length: | 212 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 12/58 - (20%) |
Similarity: | 18/58 - (31%) |
Gaps: | 25/58 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 88 RPDIFH----------TKADKKSLDPSLALRL---------------TAIRETFEELG 120
||.::| .:.|.|...|::.:.| .|..|..||.|
Fly 63 RPAVYHGIISSAKGTFDEVDLKEFPPAIGVTLELCAGIVDKNKSWVEIAREEVVEECG 120
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10194 | NP_609973.1 |
None |
CG42813 | NP_001303547.1 |
ADPRase_NUDT5 |
41..205 |
CDD:239516 |
12/58 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.