DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and nudt5

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001002086.1 Gene:nudt5 / 415176 ZFINID:ZDB-GENE-040625-63 Length:217 Species:Danio rerio


Alignment Length:175 Identity:39/175 - (22%)
Similarity:69/175 - (39%) Gaps:35/175 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 WSLHEWSVWRTPSTFKKRFETAFFMTALEQEPRVHIEPNEVKDSAWRSPLDYLQASLRKELWLPP 237
            |...|.:.:..||...:.:||      :::..||   .|...|..  ..:..|:.:|.|:..:..
Zfish    25 WVKLEKTTYVDPSGSTRTWET------VKRTTRV---ANTAADGV--GIIALLKRTLHKDCVVMV 78

  Fly   238 PQFYELSRC--LNFSS--LDN--------LRQFAAEREVKG-------IQLIHPVVHKCTNGLVH 283
            .||.....|  |.|.:  :|.        ||:...|...||       :..:.|.:..|:..:|.
Zfish    79 KQFRPPMGCNTLEFPAGLIDENESAETAALRELKEETGYKGEVVGVTPVTCLDPGLSNCSTKIVM 143

  Fly   284 L-LPGDDAYPADPD---ASNEKIE-IDLSVEEFRSKTNAKLHRSE 323
            : :.|||....:|.   ...|.:| |.|.::||:.|.:..|.:.:
Zfish   144 VHINGDDIENINPTQQLGDGEFVEVILLPLDEFQQKIDELLQKEK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
nudt5NP_001002086.1 ADPRase_NUDT5 58..202 CDD:239516 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.