DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and nudt4a

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001296990.1 Gene:nudt4a / 378990 ZFINID:ZDB-GENE-031010-33 Length:226 Species:Danio rerio


Alignment Length:151 Identity:29/151 - (19%)
Similarity:43/151 - (28%) Gaps:73/151 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 AIRETFEELGI------LLCRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVL 169
            |:||.:||.|:      ||             |.|....|..|..::.               ||
Zfish   106 AVREVYEEAGVRGTLGRLL-------------GVFEQNQDSKHRTYVY---------------VL 142

  Fly   170 PDVWSLHEW----SVWRTPSTFK-----------KRFETAFF---------MTALEQEPRVHIEP 210
            ....:|.:|    ::.|....||           |.|...:.         .....|||.::.:.
Zfish   143 TVTETLEDWEDSVNIGRKRKWFKIDEAIRVLQCHKPFHAEYLRKLTPRCGPTNGNTQEPTMNTDD 207

  Fly   211 NEVKDSAWRSPLDYLQASLRK 231
            |               ||||:
Zfish   208 N---------------ASLRQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
nudt4aNP_001296990.1 Nudix_Hydrolase_9 62..178 CDD:240024 19/99 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.