DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and Nudt19

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001004258.1 Gene:Nudt19 / 308518 RGDID:1302935 Length:357 Species:Rattus norvegicus


Alignment Length:313 Identity:115/313 - (36%)
Similarity:161/313 - (51%) Gaps:26/313 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SSLILLAKNQVEKSTSCDYNALLLTRTQKSTFMPESSVFPGGVCDASDSSPAWLEHFQRNEFSAA 76
            ::.::||......|.: .:..|||.|.|...|||.:.||||||.||:||||.|:..|...     
  Rat    10 AATVMLAAGWSHASPA-GFRLLLLQRAQNQRFMPGAHVFPGGVLDAADSSPDWVSLFAPR----- 68

  Fly    77 KLRNVGHVK-----GPR-------PDIFHTKADKKSLDPSLALRLTAIRETFEELGILLCRDSKS 129
                  |..     ||.       |.:||..||..:|...:|||:.||||||||.|:||.|...|
  Rat    69 ------HTPPRFGLGPEPPRQPSFPGLFHGDADGAALPDDVALRICAIRETFEEAGVLLLRPRDS 127

  Fly   130 LTSTSDYG-AFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDVWSLHEWSVWRTP-STFKKRFE 192
            ..::.:.. |.......|.|:..|.::...||:||..||..||:|:||:|..|.|| ....:||:
  Rat   128 ARASQEPSIALSPPAGLADWRSRVRSDPRCFLQLCAHLDCTPDIWALHDWGGWLTPYGRSSRRFD 192

  Fly   193 TAFFMTALEQEPRVHIEPNEVKDSAWRSPLDYLQASLRKELWLPPPQFYELSRCLNFSSLDNLRQ 257
            |.|.:..|.:.|||..:..||....|.||.:..:..|.||:||.||||||:.|..||:||..|.:
  Rat   193 TTFLLCCLRETPRVEPDLAEVVGYKWLSPSEATECFLSKEIWLAPPQFYEVRRLENFASLSALYR 257

  Fly   258 FAAEREVKGIQLIHPVVHKCTNGLVHLLPGDDAYPADPDASNEKIEIDLSVEE 310
            |..:..::..:...|:|...::|.:||||||:.|....|...:.:.||...||
  Rat   258 FCLDHPLEVPEKWLPIVLLTSDGSIHLLPGDELYVKGSDFLEKNMSIDKKTEE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
Nudt19NP_001004258.1 Nudix box 97..118 12/20 (60%)
Microbody targeting signal. /evidence=ECO:0000255 355..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351948
Domainoid 1 1.000 194 1.000 Domainoid score I3070
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H13211
Inparanoid 1 1.050 195 1.000 Inparanoid score I3750
OMA 1 1.010 - - QHG48383
OrthoDB 1 1.010 - - D1417901at2759
OrthoFinder 1 1.000 - - FOG0004004
OrthoInspector 1 1.000 - - otm44910
orthoMCL 1 0.900 - - OOG6_103951
Panther 1 1.100 - - LDO PTHR12318
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2766
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.