DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and NUDT7

DIOPT Version :9

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:241 Identity:49/241 - (20%)
Similarity:69/241 - (28%) Gaps:117/241 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRL-LPKIRSSSSLILLAKNQVE------KSTSCDYNA---------------LLLT-RTQKST 42
            |||| ||:....:||:..||.::.      |.:...||.               ||.| |::|..
Human     1 MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLR 65

  Fly    43 FMPESSVFPGGVCDASDSSPAWLEHFQRNEFSAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLAL 107
            ..|....||||..|.:|...|                                            
Human    66 RAPGEVCFPGGKRDPTDMDDA-------------------------------------------- 86

  Fly   108 RLTAIRETFEELGILLCRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDV 172
             .||:||..||:|:                       |.|...:|          |..:..|.|.
Human    87 -ATALREAQEEVGL-----------------------RPHQVEVV----------CCLVPCLIDT 117

  Fly   173 WSL---------HEWSVWRTPSTFKKRF--ETAFFMTALEQEPRVH 207
            .:|         |.:.....|:..|..|  ..|:|:     .|:||
Human   118 DTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFL-----HPQVH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 None
NUDT7NP_001099133.1 CoAse 41..201 CDD:239518 36/201 (18%)
Nudix box 77..98 9/65 (14%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.