DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10194 and NUDT7

DIOPT Version :10

Sequence 1:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001099133.1 Gene:NUDT7 / 283927 HGNCID:8054 Length:238 Species:Homo sapiens


Alignment Length:241 Identity:49/241 - (20%)
Similarity:69/241 - (28%) Gaps:117/241 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRL-LPKIRSSSSLILLAKNQVE------KSTSCDYNA---------------LLLT-RTQKST 42
            |||| ||:....:||:..||.::.      |.:...||.               ||.| |::|..
Human     1 MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLR 65

  Fly    43 FMPESSVFPGGVCDASDSSPAWLEHFQRNEFSAAKLRNVGHVKGPRPDIFHTKADKKSLDPSLAL 107
            ..|....||||..|.:|...|                                            
Human    66 RAPGEVCFPGGKRDPTDMDDA-------------------------------------------- 86

  Fly   108 RLTAIRETFEELGILLCRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDV 172
             .||:||..||:|:                       |.|...:|          |..:..|.|.
Human    87 -ATALREAQEEVGL-----------------------RPHQVEVV----------CCLVPCLIDT 117

  Fly   173 WSL---------HEWSVWRTPSTFKKRF--ETAFFMTALEQEPRVH 207
            .:|         |.:.....|:..|..|  ..|:|:     .|:||
Human   118 DTLITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFL-----HPQVH 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10194NP_609973.1 NUDIX_AcylCoAdiphos_Nudt19 11..245 CDD:467582 43/230 (19%)
NUDT7NP_001099133.1 NUDIX_CoAse_Nudt7 38..195 CDD:467532 37/204 (18%)
Nudix box 77..98 9/65 (14%)
Microbody targeting signal. /evidence=ECO:0000250 236..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.