powered by:
Protein Alignment CG10194 and Y92H12BL.5
DIOPT Version :9
Sequence 1: | NP_609973.1 |
Gene: | CG10194 / 35231 |
FlyBaseID: | FBgn0032790 |
Length: | 351 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_740784.1 |
Gene: | Y92H12BL.5 / 259365 |
WormBaseID: | WBGene00022366 |
Length: | 150 |
Species: | Caenorhabditis elegans |
Alignment Length: | 118 |
Identity: | 24/118 - (20%) |
Similarity: | 37/118 - (31%) |
Gaps: | 44/118 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 AIRETFEELGILLCRDSKSLTSTSDYGAFYDQFDRAHWQHIVHNNASQFLELCKQLDVLPDVWSL 175
|.||..||.|: ..|.....|.|.|...: |......:|:.::| ..|..
Worm 70 AHRELMEEAGV-------RATILKKIGMFQDDVRK-------HRTQVFLMEVSEEL----QTWEE 116
Fly 176 HEWS---VWRTPSTFKKRFETAFFMTALEQEPRVHIEPNEVKDSAWRSPLDYL 225
:|:. :| |..||.:.:| ..:.|:.||.|
Worm 117 NEYGRQRIW---------------MNVLEGKEKV--------KQSHRAMLDAL 146
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10194 | NP_609973.1 |
None |
Y92H12BL.5 | NP_740784.1 |
Nudix_Hydrolase_9 |
25..137 |
CDD:240024 |
20/107 (19%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0494 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.